Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JP83

Protein Details
Accession A0A3N4JP83    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
24-43HKFWSRKRLRWTKSDWRKSVHydrophilic
NLS Segment(s)
PositionSequence
29-31RKR
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences KLLGFQLRILRKKPFLNPLAKIHHKFWSRKRLRWTKSDWRKSVWLDEAKMQYVGYQPGRKVQIQPGEELIDKNLSTGFKFGSIGVGFWAAIVYG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.59
3 0.61
4 0.62
5 0.63
6 0.66
7 0.67
8 0.64
9 0.57
10 0.58
11 0.57
12 0.6
13 0.61
14 0.63
15 0.62
16 0.65
17 0.73
18 0.75
19 0.73
20 0.73
21 0.73
22 0.73
23 0.77
24 0.8
25 0.72
26 0.65
27 0.66
28 0.6
29 0.55
30 0.5
31 0.42
32 0.33
33 0.35
34 0.32
35 0.28
36 0.26
37 0.21
38 0.15
39 0.13
40 0.16
41 0.16
42 0.17
43 0.17
44 0.22
45 0.25
46 0.26
47 0.27
48 0.3
49 0.34
50 0.32
51 0.33
52 0.3
53 0.3
54 0.29
55 0.27
56 0.22
57 0.16
58 0.15
59 0.14
60 0.14
61 0.12
62 0.12
63 0.13
64 0.12
65 0.11
66 0.12
67 0.12
68 0.15
69 0.15
70 0.14
71 0.14
72 0.14
73 0.12
74 0.12