Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JCM7

Protein Details
Accession A0A3N4JCM7   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
52-102YLPNICPINRRKTKKKKEKRRKEKEKEKEKRKRKKERKKKRPVFVFPFFTLBasic
NLS Segment(s)
PositionSequence
61-93RRKTKKKKEKRRKEKEKEKEKRKRKKERKKKRP
Subcellular Location(s) mito 11, nucl 7.5, cyto_nucl 6, plas 2, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFVKSSSYRCTHFSLSPSFPFTSSLPNLPLAEYIYTQNVHTFSLSVSSLPFYLPNICPINRRKTKKKKEKRRKEKEKEKEKRKRKKERKKKRPVFVFPFFTLPFSLFFLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.41
4 0.42
5 0.38
6 0.33
7 0.32
8 0.29
9 0.29
10 0.26
11 0.25
12 0.23
13 0.24
14 0.24
15 0.22
16 0.21
17 0.16
18 0.15
19 0.13
20 0.13
21 0.12
22 0.13
23 0.12
24 0.13
25 0.13
26 0.12
27 0.11
28 0.1
29 0.08
30 0.09
31 0.09
32 0.08
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.06
39 0.09
40 0.09
41 0.14
42 0.16
43 0.16
44 0.21
45 0.26
46 0.35
47 0.41
48 0.48
49 0.55
50 0.64
51 0.75
52 0.81
53 0.88
54 0.89
55 0.92
56 0.96
57 0.96
58 0.96
59 0.97
60 0.97
61 0.97
62 0.96
63 0.96
64 0.95
65 0.95
66 0.95
67 0.94
68 0.94
69 0.93
70 0.94
71 0.94
72 0.95
73 0.95
74 0.96
75 0.96
76 0.97
77 0.96
78 0.96
79 0.95
80 0.94
81 0.92
82 0.89
83 0.85
84 0.75
85 0.71
86 0.6
87 0.51
88 0.41
89 0.33
90 0.26
91 0.21