Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JA84

Protein Details
Accession A0A3N4JA84   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
122-153EEPVVARTENRNRNRNRNRRRRGGARARDGVDHydrophilic
NLS Segment(s)
PositionSequence
132-148RNRNRNRNRRRRGGARA
Subcellular Location(s) cyto 12, nucl 9, mito 3, pero 3
Family & Domain DBs
Amino Acid Sequences MRIEVHLYGLGLWDIVSGKEKHPDPSDPTPPPIVSEETKKKRAAWALILQSMTDPLFVKYFRSSDPERCPPKLWAKVREDMTGEKEAEVIRTTAYDYDGGSVPSRRSAGPRVGRTRIAIVMEEPVVARTENRNRNRNRNRRRRGGARARDGVDYVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.12
4 0.12
5 0.14
6 0.22
7 0.24
8 0.28
9 0.32
10 0.37
11 0.39
12 0.46
13 0.53
14 0.49
15 0.51
16 0.49
17 0.45
18 0.42
19 0.37
20 0.32
21 0.26
22 0.32
23 0.4
24 0.44
25 0.49
26 0.49
27 0.47
28 0.49
29 0.53
30 0.48
31 0.44
32 0.44
33 0.42
34 0.43
35 0.42
36 0.36
37 0.29
38 0.26
39 0.19
40 0.13
41 0.09
42 0.07
43 0.09
44 0.09
45 0.11
46 0.12
47 0.13
48 0.13
49 0.18
50 0.21
51 0.26
52 0.34
53 0.41
54 0.44
55 0.45
56 0.46
57 0.46
58 0.52
59 0.54
60 0.52
61 0.5
62 0.5
63 0.54
64 0.53
65 0.5
66 0.43
67 0.36
68 0.34
69 0.28
70 0.24
71 0.18
72 0.17
73 0.15
74 0.14
75 0.13
76 0.09
77 0.06
78 0.06
79 0.07
80 0.06
81 0.07
82 0.07
83 0.06
84 0.08
85 0.08
86 0.09
87 0.1
88 0.11
89 0.11
90 0.13
91 0.14
92 0.13
93 0.16
94 0.19
95 0.27
96 0.34
97 0.42
98 0.47
99 0.5
100 0.51
101 0.49
102 0.47
103 0.41
104 0.33
105 0.25
106 0.19
107 0.18
108 0.16
109 0.15
110 0.12
111 0.1
112 0.1
113 0.09
114 0.1
115 0.16
116 0.26
117 0.35
118 0.44
119 0.52
120 0.6
121 0.71
122 0.81
123 0.84
124 0.86
125 0.87
126 0.89
127 0.91
128 0.93
129 0.91
130 0.91
131 0.92
132 0.91
133 0.89
134 0.86
135 0.78
136 0.7