Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4J9R3

Protein Details
Accession A0A3N4J9R3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-81TTVKPTTKSKQRIQPTKKFPLHYHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 7, mito 6, plas 4, cyto_mito 4, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MKQLFLIAIGSIITQLFINIPHPATHHDIPSRHNAETPNKEQCSNLQKAQEVEINPSGTTVKPTTKSKQRIQPTKKFPLHYHSISIGQIMGGDASM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.06
5 0.08
6 0.09
7 0.1
8 0.1
9 0.12
10 0.15
11 0.22
12 0.23
13 0.25
14 0.28
15 0.29
16 0.31
17 0.39
18 0.39
19 0.33
20 0.33
21 0.34
22 0.37
23 0.43
24 0.45
25 0.44
26 0.42
27 0.42
28 0.4
29 0.41
30 0.4
31 0.37
32 0.35
33 0.28
34 0.29
35 0.29
36 0.3
37 0.27
38 0.2
39 0.2
40 0.19
41 0.18
42 0.16
43 0.16
44 0.15
45 0.12
46 0.14
47 0.13
48 0.14
49 0.18
50 0.24
51 0.31
52 0.4
53 0.48
54 0.53
55 0.61
56 0.68
57 0.74
58 0.78
59 0.81
60 0.81
61 0.83
62 0.82
63 0.78
64 0.71
65 0.67
66 0.66
67 0.58
68 0.53
69 0.45
70 0.42
71 0.37
72 0.34
73 0.27
74 0.18
75 0.16
76 0.12