Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K7J0

Protein Details
Accession A0A3N4K7J0    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
68-96AEVPYGTIKKKKKKSEKDRYLREKACKFVHydrophilic
NLS Segment(s)
PositionSequence
76-85KKKKKKSEKD
Subcellular Location(s) mito 20, cyto 3.5, cyto_nucl 3.5, nucl 2.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNRRIVLRERGGFYYLHSTLYFLVANHVSPTTVILAVCHSQYKASRTLTGTQLKIVHIDVLGFIHYFAEVPYGTIKKKKKKSEKDRYLREKACKFVPWFLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.29
3 0.25
4 0.21
5 0.2
6 0.19
7 0.21
8 0.19
9 0.11
10 0.14
11 0.12
12 0.12
13 0.13
14 0.12
15 0.1
16 0.09
17 0.1
18 0.08
19 0.08
20 0.08
21 0.07
22 0.09
23 0.09
24 0.1
25 0.1
26 0.09
27 0.1
28 0.13
29 0.15
30 0.18
31 0.19
32 0.21
33 0.23
34 0.26
35 0.3
36 0.32
37 0.3
38 0.27
39 0.26
40 0.24
41 0.22
42 0.19
43 0.14
44 0.09
45 0.09
46 0.07
47 0.06
48 0.06
49 0.05
50 0.05
51 0.04
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.06
58 0.09
59 0.12
60 0.14
61 0.22
62 0.3
63 0.39
64 0.49
65 0.59
66 0.67
67 0.76
68 0.85
69 0.89
70 0.92
71 0.93
72 0.95
73 0.94
74 0.93
75 0.9
76 0.88
77 0.83
78 0.77
79 0.72
80 0.68
81 0.62