Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K9H8

Protein Details
Accession A0A3N4K9H8    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
43-75TGSPRPAKKNRPQGKIFREKTKPKNFKGPRAKMBasic
NLS Segment(s)
PositionSequence
46-75PRPAKKNRPQGKIFREKTKPKNFKGPRAKM
Subcellular Location(s) nucl 20, cyto_nucl 13.5, mito 3, cyto 3
Family & Domain DBs
Amino Acid Sequences MPPPDLTSYNEPSPTSQPQNNPPHYTAPNQPEQQPSLFLWGSTGSPRPAKKNRPQGKIFREKTKPKNFKGPRAKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.39
3 0.38
4 0.4
5 0.47
6 0.56
7 0.59
8 0.58
9 0.54
10 0.53
11 0.5
12 0.49
13 0.46
14 0.41
15 0.42
16 0.39
17 0.4
18 0.37
19 0.36
20 0.33
21 0.28
22 0.23
23 0.2
24 0.18
25 0.15
26 0.13
27 0.12
28 0.12
29 0.11
30 0.13
31 0.11
32 0.16
33 0.18
34 0.26
35 0.34
36 0.43
37 0.51
38 0.61
39 0.68
40 0.72
41 0.78
42 0.8
43 0.81
44 0.83
45 0.79
46 0.78
47 0.79
48 0.8
49 0.83
50 0.85
51 0.84
52 0.8
53 0.85
54 0.83
55 0.85