Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JEW6

Protein Details
Accession A0A3N4JEW6   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
202-223ETEESKKRRKGTEKPLGRTEMKBasic
NLS Segment(s)
PositionSequence
207-215KKRRKGTEK
Subcellular Location(s) mito 16, nucl 6.5, cyto_nucl 5.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013078  His_Pase_superF_clade-1  
IPR029033  His_PPase_superfam  
IPR001345  PG/BPGM_mutase_AS  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF00300  His_Phos_1  
PROSITE View protein in PROSITE  
PS00175  PG_MUTASE  
CDD cd07067  HP_PGM_like  
Amino Acid Sequences MSPKIITLVRHGQAHNNVDGKYYLHDPYLTPLGETQCHELSNKFPPKPAVELLVSSPLKRTIQTTLLGFKKLVESGVKLELLAELQEASELPCDTGSSRRVLEKEGMFKGLDFSGLPEDWTSKQGKWAPDPDLLRERARVVRKWLKARSESHVVAVLHGGFLQYLTEDWAGHGDLPGPGWSNTEFRSYVFVDGGEDNVSIVETEESKKRRKGTEKPLGRTEMKQFEKVVRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.48
3 0.43
4 0.39
5 0.36
6 0.36
7 0.3
8 0.25
9 0.24
10 0.2
11 0.18
12 0.19
13 0.17
14 0.21
15 0.25
16 0.22
17 0.19
18 0.21
19 0.22
20 0.24
21 0.25
22 0.25
23 0.21
24 0.22
25 0.23
26 0.21
27 0.22
28 0.3
29 0.37
30 0.33
31 0.35
32 0.38
33 0.4
34 0.43
35 0.41
36 0.35
37 0.28
38 0.28
39 0.27
40 0.31
41 0.28
42 0.24
43 0.24
44 0.23
45 0.22
46 0.22
47 0.22
48 0.18
49 0.21
50 0.23
51 0.24
52 0.28
53 0.29
54 0.29
55 0.27
56 0.23
57 0.22
58 0.19
59 0.19
60 0.13
61 0.13
62 0.14
63 0.16
64 0.15
65 0.13
66 0.13
67 0.11
68 0.1
69 0.09
70 0.06
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.07
82 0.1
83 0.11
84 0.12
85 0.13
86 0.16
87 0.16
88 0.18
89 0.22
90 0.21
91 0.24
92 0.23
93 0.23
94 0.21
95 0.2
96 0.2
97 0.15
98 0.13
99 0.07
100 0.07
101 0.07
102 0.07
103 0.08
104 0.06
105 0.08
106 0.09
107 0.11
108 0.13
109 0.11
110 0.17
111 0.21
112 0.23
113 0.25
114 0.29
115 0.29
116 0.33
117 0.34
118 0.32
119 0.33
120 0.33
121 0.31
122 0.28
123 0.27
124 0.28
125 0.32
126 0.3
127 0.34
128 0.4
129 0.46
130 0.53
131 0.57
132 0.57
133 0.58
134 0.59
135 0.56
136 0.55
137 0.48
138 0.41
139 0.41
140 0.34
141 0.28
142 0.26
143 0.2
144 0.12
145 0.11
146 0.1
147 0.05
148 0.05
149 0.04
150 0.03
151 0.04
152 0.06
153 0.06
154 0.06
155 0.06
156 0.08
157 0.08
158 0.08
159 0.08
160 0.07
161 0.07
162 0.08
163 0.08
164 0.09
165 0.09
166 0.11
167 0.12
168 0.14
169 0.15
170 0.18
171 0.18
172 0.16
173 0.2
174 0.2
175 0.2
176 0.18
177 0.17
178 0.15
179 0.15
180 0.15
181 0.12
182 0.11
183 0.09
184 0.08
185 0.08
186 0.06
187 0.07
188 0.07
189 0.07
190 0.1
191 0.18
192 0.23
193 0.3
194 0.36
195 0.42
196 0.5
197 0.59
198 0.66
199 0.7
200 0.77
201 0.8
202 0.82
203 0.83
204 0.8
205 0.74
206 0.69
207 0.67
208 0.66
209 0.6
210 0.57
211 0.52