Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IYE8

Protein Details
Accession A0A3N4IYE8    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
50-82KTNRPQSKIFREKTKPKNSKGPRAKTKNQPIAKHydrophilic
84-117LEVKKTQRLRPKSHSRQKTKPTPGRKVGKPKNPSBasic
NLS Segment(s)
PositionSequence
50-115KTNRPQSKIFREKTKPKNSKGPRAKTKNQPIAKGLEVKKTQRLRPKSHSRQKTKPTPGRKVGKPKN
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MPPPDLTSHNEPSPTSQPQNNPPHHTAPKQPEQQPSVFYGGQRYPQGQRKTNRPQSKIFREKTKPKNSKGPRAKTKNQPIAKGLEVKKTQRLRPKSHSRQKTKPTPGRKVGKPKNPSNLETRVCPNGRSNEQTRRGKAKRQVPYDQLYPGQQNERIPIKEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.4
4 0.44
5 0.52
6 0.62
7 0.62
8 0.63
9 0.61
10 0.65
11 0.65
12 0.63
13 0.62
14 0.61
15 0.63
16 0.65
17 0.66
18 0.64
19 0.63
20 0.61
21 0.54
22 0.48
23 0.44
24 0.36
25 0.3
26 0.28
27 0.25
28 0.28
29 0.27
30 0.27
31 0.28
32 0.36
33 0.43
34 0.46
35 0.49
36 0.55
37 0.65
38 0.72
39 0.74
40 0.7
41 0.71
42 0.74
43 0.79
44 0.79
45 0.73
46 0.72
47 0.72
48 0.78
49 0.8
50 0.81
51 0.78
52 0.74
53 0.8
54 0.77
55 0.79
56 0.79
57 0.79
58 0.78
59 0.79
60 0.81
61 0.8
62 0.83
63 0.82
64 0.75
65 0.68
66 0.59
67 0.54
68 0.48
69 0.45
70 0.36
71 0.34
72 0.34
73 0.33
74 0.39
75 0.41
76 0.45
77 0.46
78 0.52
79 0.53
80 0.6
81 0.69
82 0.72
83 0.77
84 0.82
85 0.81
86 0.83
87 0.85
88 0.86
89 0.85
90 0.83
91 0.83
92 0.82
93 0.83
94 0.82
95 0.8
96 0.81
97 0.79
98 0.8
99 0.79
100 0.77
101 0.78
102 0.74
103 0.69
104 0.64
105 0.63
106 0.56
107 0.51
108 0.48
109 0.46
110 0.41
111 0.41
112 0.4
113 0.39
114 0.42
115 0.45
116 0.48
117 0.5
118 0.59
119 0.65
120 0.66
121 0.69
122 0.69
123 0.71
124 0.73
125 0.73
126 0.73
127 0.72
128 0.74
129 0.71
130 0.72
131 0.66
132 0.62
133 0.55
134 0.49
135 0.45
136 0.41
137 0.4
138 0.37
139 0.35
140 0.38
141 0.42