Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4K1K8

Protein Details
Accession A0A3N4K1K8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
18-42RYTVVQYSPTRRRKKEKDVAWCLKLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, plas 7, golg 4, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLHQSTWSGIYGVWWVGRYTVVQYSPTRRRKKEKDVAWCLKLLNLIIFLSFFFCNPPELRSRFCCGRGECAPLLSSPLLHLFCLDAFFSGYIGLPCKERRRRVDERSWLVMMCGGKRGNPSKDKGNEKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.11
4 0.12
5 0.12
6 0.13
7 0.16
8 0.16
9 0.19
10 0.23
11 0.32
12 0.41
13 0.51
14 0.57
15 0.61
16 0.7
17 0.76
18 0.83
19 0.84
20 0.82
21 0.83
22 0.85
23 0.85
24 0.76
25 0.68
26 0.57
27 0.48
28 0.41
29 0.3
30 0.19
31 0.12
32 0.1
33 0.08
34 0.08
35 0.07
36 0.08
37 0.08
38 0.07
39 0.07
40 0.07
41 0.1
42 0.1
43 0.12
44 0.15
45 0.17
46 0.21
47 0.23
48 0.27
49 0.28
50 0.3
51 0.33
52 0.29
53 0.33
54 0.32
55 0.33
56 0.28
57 0.26
58 0.24
59 0.19
60 0.2
61 0.14
62 0.12
63 0.08
64 0.11
65 0.1
66 0.1
67 0.1
68 0.08
69 0.08
70 0.1
71 0.09
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.08
80 0.08
81 0.11
82 0.16
83 0.26
84 0.35
85 0.43
86 0.5
87 0.58
88 0.67
89 0.73
90 0.79
91 0.79
92 0.78
93 0.75
94 0.68
95 0.59
96 0.49
97 0.44
98 0.35
99 0.25
100 0.24
101 0.19
102 0.2
103 0.27
104 0.34
105 0.39
106 0.44
107 0.48
108 0.53
109 0.61