Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JMH9

Protein Details
Accession A0A3N4JMH9    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MEGKGSGKREKGKGKREKWRGQNKLGGTVERERKREKKREKAVVVCBasic
NLS Segment(s)
PositionSequence
4-41KGSGKREKGKGKREKWRGQNKLGGTVERERKREKKREK
Subcellular Location(s) nucl 8, mito 6, cyto 5, plas 5, extr 1, pero 1, E.R. 1
Family & Domain DBs
Amino Acid Sequences MEGKGSGKREKGKGKREKWRGQNKLGGTVERERKREKKREKAVVVCGDDGQSAGIIFASTLVCVCMRGVCGFLCVCVSVCVCGCVCVWCV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.87
4 0.88
5 0.88
6 0.9
7 0.87
8 0.84
9 0.81
10 0.72
11 0.7
12 0.62
13 0.53
14 0.46
15 0.45
16 0.47
17 0.45
18 0.48
19 0.45
20 0.53
21 0.61
22 0.68
23 0.71
24 0.72
25 0.77
26 0.83
27 0.83
28 0.79
29 0.76
30 0.72
31 0.63
32 0.53
33 0.43
34 0.33
35 0.26
36 0.2
37 0.13
38 0.06
39 0.04
40 0.04
41 0.03
42 0.03
43 0.03
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.05
52 0.05
53 0.07
54 0.07
55 0.09
56 0.08
57 0.11
58 0.1
59 0.1
60 0.1
61 0.1
62 0.1
63 0.11
64 0.11
65 0.11
66 0.11
67 0.13
68 0.12
69 0.13
70 0.13