Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JK25

Protein Details
Accession A0A3N4JK25   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MHPKPPYAKRNNSNRQPVISHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 12.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MHPKPPYAKRNNSNRQPVISCIEPPVDEGLSSSLDVVLSVGLNRYVHSGNGLKGLWRNLCCAKAEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.76
3 0.68
4 0.61
5 0.55
6 0.46
7 0.38
8 0.29
9 0.26
10 0.21
11 0.19
12 0.18
13 0.13
14 0.11
15 0.1
16 0.09
17 0.09
18 0.09
19 0.07
20 0.05
21 0.05
22 0.05
23 0.05
24 0.04
25 0.03
26 0.03
27 0.04
28 0.05
29 0.05
30 0.06
31 0.08
32 0.09
33 0.09
34 0.13
35 0.14
36 0.14
37 0.18
38 0.18
39 0.17
40 0.2
41 0.26
42 0.28
43 0.27
44 0.32
45 0.32
46 0.35