Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JKY3

Protein Details
Accession A0A3N4JKY3    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
40-67AKRLPFSPRLRQIKKKKKTTDLAWRGKIHydrophilic
NLS Segment(s)
PositionSequence
46-57SPRLRQIKKKKK
Subcellular Location(s) mito 13.5, mito_nucl 12.833, nucl 11, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MARKSSNFPNCTYTVKTEIIENHARTSRISPSGLSGENTAKRLPFSPRLRQIKKKKKTTDLAWRGKIQRPSEILNYFGFYGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.33
4 0.31
5 0.3
6 0.32
7 0.35
8 0.32
9 0.31
10 0.32
11 0.32
12 0.29
13 0.3
14 0.28
15 0.24
16 0.24
17 0.2
18 0.2
19 0.22
20 0.22
21 0.19
22 0.17
23 0.18
24 0.19
25 0.2
26 0.17
27 0.15
28 0.15
29 0.16
30 0.19
31 0.24
32 0.29
33 0.37
34 0.46
35 0.56
36 0.63
37 0.71
38 0.78
39 0.79
40 0.83
41 0.85
42 0.84
43 0.83
44 0.85
45 0.84
46 0.84
47 0.83
48 0.83
49 0.78
50 0.76
51 0.72
52 0.7
53 0.69
54 0.6
55 0.56
56 0.51
57 0.5
58 0.51
59 0.48
60 0.43
61 0.37
62 0.37