Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JJ51

Protein Details
Accession A0A3N4JJ51    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
69-99PPTNPPVHPFPKKKKSHSIINHKNKNKQKNSHydrophilic
NLS Segment(s)
PositionSequence
79-97PKKKKSHSIINHKNKNKQK
Subcellular Location(s) nucl 13.5, cyto_nucl 8.5, mito 8, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MIFHAEFFLSFFLFHLSSPTFPPFSVSRCIIRVIHNDGVVVFPKQCILDFNFDFCTFIYPFIRQTPPYPPTNPPVHPFPKKKKSHSIINHKNKNKQKNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.13
4 0.14
5 0.17
6 0.2
7 0.18
8 0.18
9 0.22
10 0.2
11 0.21
12 0.25
13 0.24
14 0.24
15 0.24
16 0.28
17 0.26
18 0.28
19 0.3
20 0.31
21 0.31
22 0.28
23 0.27
24 0.24
25 0.23
26 0.2
27 0.16
28 0.1
29 0.07
30 0.08
31 0.08
32 0.08
33 0.08
34 0.1
35 0.15
36 0.15
37 0.17
38 0.18
39 0.17
40 0.18
41 0.16
42 0.17
43 0.11
44 0.13
45 0.13
46 0.12
47 0.14
48 0.17
49 0.2
50 0.18
51 0.2
52 0.27
53 0.29
54 0.33
55 0.35
56 0.34
57 0.38
58 0.43
59 0.43
60 0.39
61 0.43
62 0.47
63 0.54
64 0.6
65 0.65
66 0.69
67 0.75
68 0.79
69 0.82
70 0.8
71 0.81
72 0.82
73 0.83
74 0.84
75 0.86
76 0.89
77 0.86
78 0.89
79 0.88