Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4KFW2

Protein Details
Accession A0A3N4KFW2    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
59-79TKNPLKGGIKRWRWRWRVRVQHydrophilic
NLS Segment(s)
PositionSequence
64-73KGGIKRWRWR
Subcellular Location(s) mito 17.5, cyto_mito 11.833, cyto 5, cyto_nucl 4.833, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MRAELATWAVTIVALPFERRGMAKRGAKGQKVQLSPMFILITQKPTKLTLNPIPPPPITKNPLKGGIKRWRWRWRVRVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.09
5 0.11
6 0.12
7 0.15
8 0.18
9 0.26
10 0.3
11 0.33
12 0.43
13 0.48
14 0.5
15 0.51
16 0.54
17 0.52
18 0.48
19 0.47
20 0.39
21 0.35
22 0.32
23 0.29
24 0.21
25 0.14
26 0.15
27 0.13
28 0.16
29 0.14
30 0.15
31 0.15
32 0.17
33 0.19
34 0.19
35 0.25
36 0.26
37 0.34
38 0.37
39 0.39
40 0.4
41 0.39
42 0.42
43 0.41
44 0.41
45 0.38
46 0.4
47 0.44
48 0.46
49 0.55
50 0.55
51 0.54
52 0.56
53 0.62
54 0.66
55 0.69
56 0.74
57 0.75
58 0.79
59 0.85