Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JEA4

Protein Details
Accession A0A3N4JEA4    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
40-65IKSHTREKASRYRRREKYKMYSYSLFHydrophilic
NLS Segment(s)
PositionSequence
34-56GKQIRRIKSHTREKASRYRRREK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MKKEKGIACQRRTNTTRCGQNTARTAGSRKVVLGKQIRRIKSHTREKASRYRRREKYKMYSYSLFVTLYLPLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.59
3 0.61
4 0.56
5 0.6
6 0.53
7 0.56
8 0.56
9 0.52
10 0.46
11 0.39
12 0.38
13 0.34
14 0.33
15 0.26
16 0.22
17 0.24
18 0.22
19 0.28
20 0.33
21 0.33
22 0.4
23 0.46
24 0.48
25 0.45
26 0.5
27 0.52
28 0.54
29 0.61
30 0.6
31 0.62
32 0.66
33 0.69
34 0.75
35 0.75
36 0.75
37 0.74
38 0.76
39 0.78
40 0.82
41 0.86
42 0.85
43 0.85
44 0.86
45 0.84
46 0.8
47 0.74
48 0.66
49 0.6
50 0.52
51 0.42
52 0.32
53 0.25