Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K3I8

Protein Details
Accession A0A3N4K3I8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
64-84GEHRFCGKKRGPRKAIQSQTRBasic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 10, plas 3, cyto 1, E.R. 1, golg 1
Family & Domain DBs
Amino Acid Sequences MITVKVCLLVCPGALLHKGRRGDFWAGGNSAGPRSCSRISLRDYTWRFSCMGPFLGCSNLWSLGEHRFCGKKRGPRKAIQSQTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.19
4 0.25
5 0.28
6 0.28
7 0.3
8 0.32
9 0.33
10 0.33
11 0.31
12 0.28
13 0.25
14 0.25
15 0.23
16 0.19
17 0.17
18 0.14
19 0.13
20 0.11
21 0.15
22 0.16
23 0.18
24 0.2
25 0.24
26 0.27
27 0.3
28 0.31
29 0.35
30 0.36
31 0.37
32 0.35
33 0.31
34 0.28
35 0.24
36 0.24
37 0.17
38 0.18
39 0.15
40 0.15
41 0.14
42 0.15
43 0.15
44 0.13
45 0.13
46 0.12
47 0.12
48 0.12
49 0.13
50 0.19
51 0.2
52 0.21
53 0.23
54 0.29
55 0.3
56 0.38
57 0.44
58 0.46
59 0.55
60 0.66
61 0.69
62 0.71
63 0.8
64 0.82