Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JTT8

Protein Details
Accession A0A3N4JTT8    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
91-147ISIYPFAPKKKKINKGKRKEDREEKNCFRENRKFTIPKKRKNPIKENKKKRRSKRLGBasic
NLS Segment(s)
PositionSequence
98-147PKKKKINKGKRKEDREEKNCFRENRKFTIPKKRKNPIKENKKKRRSKRLG
Subcellular Location(s) mito 16.5, mito_nucl 14, nucl 10.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPYTRVFTPTVPCRRFPCFSRAGKSWNSGVIGEGRKERTLRVILTHKPRDMTLSTQLVFLPNACLITWTAPTVYAMIQYTILYIFYNNSRISIYPFAPKKKKINKGKRKEDREEKNCFRENRKFTIPKKRKNPIKENKKKRRSKRLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.59
3 0.54
4 0.53
5 0.51
6 0.55
7 0.58
8 0.57
9 0.56
10 0.55
11 0.54
12 0.48
13 0.42
14 0.37
15 0.29
16 0.27
17 0.27
18 0.25
19 0.24
20 0.26
21 0.25
22 0.27
23 0.27
24 0.27
25 0.26
26 0.27
27 0.26
28 0.28
29 0.32
30 0.36
31 0.46
32 0.5
33 0.46
34 0.44
35 0.43
36 0.4
37 0.35
38 0.32
39 0.28
40 0.27
41 0.25
42 0.25
43 0.25
44 0.22
45 0.2
46 0.16
47 0.11
48 0.07
49 0.08
50 0.07
51 0.07
52 0.07
53 0.08
54 0.08
55 0.07
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.05
68 0.06
69 0.05
70 0.05
71 0.05
72 0.06
73 0.1
74 0.09
75 0.1
76 0.11
77 0.11
78 0.15
79 0.17
80 0.17
81 0.22
82 0.27
83 0.35
84 0.4
85 0.46
86 0.53
87 0.6
88 0.68
89 0.72
90 0.78
91 0.81
92 0.86
93 0.91
94 0.92
95 0.91
96 0.91
97 0.91
98 0.9
99 0.87
100 0.86
101 0.83
102 0.81
103 0.79
104 0.73
105 0.71
106 0.7
107 0.68
108 0.65
109 0.68
110 0.68
111 0.69
112 0.76
113 0.78
114 0.78
115 0.83
116 0.86
117 0.86
118 0.87
119 0.9
120 0.9
121 0.91
122 0.92
123 0.93
124 0.94
125 0.95
126 0.95
127 0.95