Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JNR7

Protein Details
Accession A0A3N4JNR7   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
46-68PSRNERYERGAKKKKSGRKKLMLBasic
NLS Segment(s)
PositionSequence
48-66RNERYERGAKKKKSGRKKL
Subcellular Location(s) mito 18, nucl 7, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences TGQAGKKSSVLLRLTGKHKLELEPYKSTLTDKVGWPKTPRINANHPSRNERYERGAKKKKSGRKKLML
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.43
4 0.4
5 0.4
6 0.38
7 0.41
8 0.42
9 0.43
10 0.39
11 0.4
12 0.37
13 0.35
14 0.34
15 0.28
16 0.24
17 0.21
18 0.2
19 0.27
20 0.28
21 0.31
22 0.33
23 0.37
24 0.39
25 0.42
26 0.44
27 0.41
28 0.47
29 0.53
30 0.6
31 0.61
32 0.59
33 0.61
34 0.6
35 0.6
36 0.55
37 0.5
38 0.48
39 0.51
40 0.57
41 0.61
42 0.67
43 0.68
44 0.74
45 0.8
46 0.82
47 0.83
48 0.85