Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4K9P8

Protein Details
Accession A0A3N4K9P8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
67-103YHTIGVAPGKKKKKKRKKKERKKERKKTKAELVPASHBasic
NLS Segment(s)
PositionSequence
74-96PGKKKKKKRKKKERKKERKKTKA
Subcellular Location(s) mito 15.5, mito_nucl 12.999, nucl 9, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MAWQVCPSPLTHQPELRLSSRCPPASLPIKSSPTVPYGTVQSKAEVEVGPQIQLCVVSGRKYSITAYHTIGVAPGKKKKKKRKKKERKKERKKTKAELVPASHAVAEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.47
4 0.43
5 0.38
6 0.41
7 0.46
8 0.43
9 0.38
10 0.35
11 0.4
12 0.45
13 0.45
14 0.41
15 0.4
16 0.43
17 0.42
18 0.42
19 0.35
20 0.29
21 0.28
22 0.24
23 0.18
24 0.19
25 0.21
26 0.22
27 0.2
28 0.19
29 0.17
30 0.17
31 0.17
32 0.12
33 0.1
34 0.11
35 0.11
36 0.1
37 0.1
38 0.09
39 0.08
40 0.08
41 0.07
42 0.06
43 0.06
44 0.07
45 0.08
46 0.09
47 0.1
48 0.11
49 0.11
50 0.13
51 0.15
52 0.16
53 0.18
54 0.18
55 0.17
56 0.16
57 0.17
58 0.15
59 0.17
60 0.19
61 0.25
62 0.34
63 0.43
64 0.53
65 0.64
66 0.73
67 0.8
68 0.87
69 0.91
70 0.93
71 0.96
72 0.97
73 0.98
74 0.98
75 0.98
76 0.98
77 0.98
78 0.97
79 0.96
80 0.94
81 0.93
82 0.91
83 0.88
84 0.85
85 0.79
86 0.74
87 0.65
88 0.57