Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JH56

Protein Details
Accession A0A3N4JH56   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-37LTVPKGKESGGKKKRKREGRERWVQIGSBasic
NLS Segment(s)
PositionSequence
14-31KGKESGGKKKRKREGRER
66-68RKN
78-80KKR
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVRGEVVEDLTVPKGKESGGKKKRKREGRERWVQIGSLRDAKIWFWPREVRILTRNGRNSDNDPKRKNAKIHTISDHKKRGGGKTLLPLNDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.2
4 0.26
5 0.35
6 0.43
7 0.53
8 0.61
9 0.71
10 0.8
11 0.84
12 0.86
13 0.86
14 0.87
15 0.87
16 0.9
17 0.85
18 0.8
19 0.71
20 0.62
21 0.53
22 0.45
23 0.36
24 0.3
25 0.25
26 0.2
27 0.2
28 0.19
29 0.24
30 0.27
31 0.25
32 0.23
33 0.25
34 0.26
35 0.31
36 0.32
37 0.28
38 0.25
39 0.32
40 0.34
41 0.38
42 0.43
43 0.4
44 0.41
45 0.41
46 0.43
47 0.47
48 0.52
49 0.54
50 0.52
51 0.57
52 0.62
53 0.65
54 0.66
55 0.62
56 0.63
57 0.61
58 0.65
59 0.65
60 0.68
61 0.7
62 0.73
63 0.73
64 0.63
65 0.6
66 0.59
67 0.57
68 0.57
69 0.54
70 0.5
71 0.51
72 0.57