Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JSZ8

Protein Details
Accession A0A3N4JSZ8    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
115-141QMKPLYKKMTFVKKKPCPKMSKESGGAHydrophilic
NLS Segment(s)
PositionSequence
86-136GRKKLRKRSGSGKPGPKSLPKLQIPQEKPQMKPLYKKMTFVKKKPCPKMSK
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MIYTPSASKPSDDLGSNTDFEAFNKKMKKFEKLSDEEEKALISRIIKTIDEKIIEGVEKLAEELYSGRSWKTSQYPRFPLGSPVEGRKKLRKRSGSGKPGPKSLPKLQIPQEKPQMKPLYKKMTFVKKKPCPKMSKESGGAPLKRQIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.25
4 0.23
5 0.21
6 0.18
7 0.17
8 0.22
9 0.2
10 0.24
11 0.31
12 0.32
13 0.39
14 0.43
15 0.51
16 0.49
17 0.56
18 0.59
19 0.58
20 0.62
21 0.62
22 0.6
23 0.52
24 0.47
25 0.39
26 0.29
27 0.24
28 0.19
29 0.12
30 0.11
31 0.12
32 0.14
33 0.14
34 0.16
35 0.18
36 0.2
37 0.2
38 0.19
39 0.17
40 0.16
41 0.16
42 0.14
43 0.1
44 0.07
45 0.06
46 0.06
47 0.05
48 0.04
49 0.04
50 0.05
51 0.07
52 0.07
53 0.08
54 0.08
55 0.08
56 0.09
57 0.12
58 0.19
59 0.26
60 0.32
61 0.39
62 0.43
63 0.45
64 0.46
65 0.44
66 0.41
67 0.34
68 0.31
69 0.26
70 0.28
71 0.32
72 0.34
73 0.37
74 0.42
75 0.47
76 0.53
77 0.61
78 0.62
79 0.62
80 0.68
81 0.75
82 0.76
83 0.77
84 0.77
85 0.71
86 0.69
87 0.66
88 0.61
89 0.58
90 0.54
91 0.55
92 0.49
93 0.53
94 0.56
95 0.63
96 0.61
97 0.62
98 0.65
99 0.61
100 0.59
101 0.61
102 0.63
103 0.57
104 0.61
105 0.62
106 0.63
107 0.6
108 0.64
109 0.63
110 0.65
111 0.7
112 0.71
113 0.73
114 0.72
115 0.81
116 0.85
117 0.87
118 0.84
119 0.83
120 0.85
121 0.83
122 0.83
123 0.76
124 0.71
125 0.7
126 0.7
127 0.64
128 0.58