Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K5C2

Protein Details
Accession A0A3N4K5C2    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
64-83EPYFCSKLRTIPKKDKRHKGBasic
NLS Segment(s)
PositionSequence
75-83PKKDKRHKG
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MVVQSHPAIPDRAEPDISLNRKNSTAAPSSHIKALVDPENRGIRIRIDFECKLPLVLIQFLSAEPYFCSKLRTIPKKDKRHKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.32
4 0.35
5 0.34
6 0.33
7 0.32
8 0.32
9 0.33
10 0.3
11 0.27
12 0.27
13 0.24
14 0.25
15 0.27
16 0.27
17 0.28
18 0.26
19 0.21
20 0.18
21 0.2
22 0.23
23 0.21
24 0.2
25 0.22
26 0.24
27 0.24
28 0.24
29 0.21
30 0.16
31 0.16
32 0.19
33 0.16
34 0.2
35 0.21
36 0.22
37 0.24
38 0.22
39 0.2
40 0.17
41 0.16
42 0.12
43 0.12
44 0.11
45 0.09
46 0.09
47 0.09
48 0.12
49 0.11
50 0.1
51 0.1
52 0.13
53 0.15
54 0.15
55 0.19
56 0.17
57 0.25
58 0.35
59 0.45
60 0.51
61 0.6
62 0.7
63 0.78