Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4J9K5

Protein Details
Accession A0A3N4J9K5   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-36LSTIPRRKPSKSQRVLRNLAHHydrophilic
NLS Segment(s)
PositionSequence
21-51RRKPSKSQRVLRNLAHPLRSRQERKARKLEK
Subcellular Location(s) mito 16.5, mito_nucl 13.166, nucl 8.5, cyto_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MTSGSYDQTASSLLPLSTIPRRKPSKSQRVLRNLAHPLRSRQERKARKLEKIQKENEARVANIDDFLEGGRIFYERQYGVGRKYGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.13
4 0.2
5 0.27
6 0.3
7 0.38
8 0.44
9 0.48
10 0.59
11 0.66
12 0.69
13 0.72
14 0.77
15 0.78
16 0.81
17 0.83
18 0.75
19 0.71
20 0.67
21 0.61
22 0.57
23 0.49
24 0.44
25 0.45
26 0.5
27 0.46
28 0.47
29 0.54
30 0.58
31 0.63
32 0.7
33 0.68
34 0.67
35 0.74
36 0.76
37 0.76
38 0.76
39 0.72
40 0.7
41 0.69
42 0.64
43 0.6
44 0.51
45 0.41
46 0.34
47 0.33
48 0.24
49 0.2
50 0.18
51 0.11
52 0.1
53 0.1
54 0.09
55 0.06
56 0.06
57 0.06
58 0.07
59 0.07
60 0.08
61 0.13
62 0.12
63 0.15
64 0.21
65 0.25
66 0.27