Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JCW9

Protein Details
Accession A0A3N4JCW9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
73-98ISNRERIDRRHHKPLRHPPHGRLNLNBasic
NLS Segment(s)
PositionSequence
81-90RRHHKPLRHP
Subcellular Location(s) extr 20, E.R. 3, plas 2
Family & Domain DBs
Amino Acid Sequences MLSHKVVLSCQALFGVPLVVSLRKFGGCGCQPQPWHDYPTSLGHCLLFIFYDLFTSDKLWAIISGGLYPVGRISNRERIDRRHHKPLRHPPHGRLNLNRKLSCHELDEVRQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.07
4 0.08
5 0.09
6 0.1
7 0.1
8 0.12
9 0.13
10 0.11
11 0.12
12 0.11
13 0.18
14 0.19
15 0.25
16 0.27
17 0.31
18 0.32
19 0.35
20 0.4
21 0.34
22 0.36
23 0.3
24 0.28
25 0.25
26 0.31
27 0.3
28 0.26
29 0.24
30 0.19
31 0.19
32 0.17
33 0.15
34 0.08
35 0.06
36 0.05
37 0.05
38 0.05
39 0.05
40 0.06
41 0.06
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.06
49 0.07
50 0.06
51 0.06
52 0.05
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.09
60 0.14
61 0.23
62 0.26
63 0.33
64 0.36
65 0.42
66 0.53
67 0.61
68 0.63
69 0.65
70 0.69
71 0.7
72 0.77
73 0.81
74 0.81
75 0.81
76 0.8
77 0.76
78 0.81
79 0.83
80 0.78
81 0.77
82 0.76
83 0.74
84 0.78
85 0.72
86 0.63
87 0.6
88 0.59
89 0.52
90 0.46
91 0.42
92 0.38