Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4IZE5

Protein Details
Accession A0A3N4IZE5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
57-82KTKQAWQGKKYKIKKLKRMDAKGVDSHydrophilic
NLS Segment(s)
PositionSequence
61-74AWQGKKYKIKKLKR
Subcellular Location(s) cyto_nucl 11.166, cyto 11, nucl 10, cyto_mito 8.166, mito_nucl 7.666, mito 4
Family & Domain DBs
Amino Acid Sequences MISGNWKGPFYVWTLETKQEKEQAKKEITEILKEAELRVARELWAAAVEPGVGEKIKTKQAWQGKKYKIKKLKRMDAKGVDSWRYVTSLYRLLLWPTCLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.32
3 0.35
4 0.36
5 0.37
6 0.4
7 0.46
8 0.47
9 0.51
10 0.52
11 0.51
12 0.49
13 0.47
14 0.47
15 0.41
16 0.37
17 0.32
18 0.25
19 0.23
20 0.22
21 0.21
22 0.17
23 0.17
24 0.15
25 0.15
26 0.14
27 0.12
28 0.12
29 0.12
30 0.08
31 0.07
32 0.06
33 0.05
34 0.04
35 0.04
36 0.03
37 0.03
38 0.04
39 0.03
40 0.03
41 0.06
42 0.08
43 0.14
44 0.14
45 0.16
46 0.23
47 0.32
48 0.41
49 0.45
50 0.52
51 0.56
52 0.66
53 0.72
54 0.75
55 0.77
56 0.77
57 0.82
58 0.83
59 0.84
60 0.85
61 0.85
62 0.84
63 0.82
64 0.77
65 0.73
66 0.68
67 0.6
68 0.5
69 0.44
70 0.35
71 0.29
72 0.24
73 0.2
74 0.19
75 0.22
76 0.21
77 0.22
78 0.22
79 0.24
80 0.27