Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4K2K9

Protein Details
Accession A0A3N4K2K9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-35VDSPYSAETNKKKKNNRPCQERQIQGPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 2
Family & Domain DBs
Amino Acid Sequences MKNCTLPTVDSPYSAETNKKKKNNRPCQERQIQGPTSSSVNSNRDIYERVVKWTYSIGHNAQLLNHGLLLEYEFHEVEASLRNPRVDRGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.33
4 0.43
5 0.51
6 0.58
7 0.64
8 0.71
9 0.81
10 0.85
11 0.87
12 0.86
13 0.87
14 0.88
15 0.87
16 0.8
17 0.75
18 0.72
19 0.63
20 0.55
21 0.46
22 0.37
23 0.3
24 0.27
25 0.22
26 0.19
27 0.19
28 0.19
29 0.19
30 0.18
31 0.18
32 0.19
33 0.19
34 0.21
35 0.2
36 0.22
37 0.22
38 0.21
39 0.21
40 0.21
41 0.21
42 0.16
43 0.2
44 0.17
45 0.19
46 0.2
47 0.2
48 0.18
49 0.19
50 0.18
51 0.14
52 0.13
53 0.1
54 0.08
55 0.08
56 0.09
57 0.08
58 0.08
59 0.09
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.14
66 0.15
67 0.19
68 0.21
69 0.24
70 0.25