Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JKX5

Protein Details
Accession A0A3N4JKX5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
46-70RSPPYPIPWKIPKRPGNKNTPQRNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 12.5, mito 9.5
Family & Domain DBs
Amino Acid Sequences MQLIPLYKIARDTTPGPVFSKVQHQPTSGLPALQNSQNSSQLLPTRSPPYPIPWKIPKRPGNKNTPQRNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.32
3 0.31
4 0.32
5 0.31
6 0.29
7 0.35
8 0.31
9 0.34
10 0.35
11 0.34
12 0.33
13 0.33
14 0.39
15 0.3
16 0.25
17 0.19
18 0.18
19 0.19
20 0.19
21 0.18
22 0.13
23 0.15
24 0.16
25 0.17
26 0.15
27 0.16
28 0.18
29 0.19
30 0.18
31 0.2
32 0.23
33 0.23
34 0.26
35 0.25
36 0.29
37 0.37
38 0.39
39 0.44
40 0.49
41 0.58
42 0.63
43 0.72
44 0.74
45 0.73
46 0.81
47 0.82
48 0.82
49 0.84
50 0.86