Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4KJP3

Protein Details
Accession A0A3N4KJP3    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
43-64RPTVNLRSKTRRSRHNHTCSGCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 5.5, nucl 5, cyto_pero 3.5
Family & Domain DBs
Amino Acid Sequences MPSTPPHNGPKGEWTTPTRVRIPALLDMGVSQAEASCQTGVPRPTVNLRSKTRRSRHNHTCSGCPPENVWKMLKQRIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.46
3 0.5
4 0.52
5 0.46
6 0.41
7 0.4
8 0.37
9 0.36
10 0.31
11 0.27
12 0.22
13 0.19
14 0.17
15 0.16
16 0.13
17 0.1
18 0.05
19 0.04
20 0.04
21 0.04
22 0.05
23 0.04
24 0.05
25 0.06
26 0.09
27 0.1
28 0.12
29 0.12
30 0.12
31 0.17
32 0.24
33 0.3
34 0.34
35 0.4
36 0.48
37 0.56
38 0.65
39 0.67
40 0.71
41 0.73
42 0.76
43 0.8
44 0.81
45 0.81
46 0.75
47 0.76
48 0.71
49 0.71
50 0.63
51 0.54
52 0.47
53 0.47
54 0.48
55 0.44
56 0.42
57 0.4
58 0.45
59 0.53