Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K8K1

Protein Details
Accession A0A3N4K8K1    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
238-259DWQKAFKSFKKDQKKGKVTFDNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, mito_nucl 13.666, cyto_nucl 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR007307  Ltv1  
Gene Ontology GO:0042274  P:ribosomal small subunit biogenesis  
Pfam View protein in Pfam  
PF04180  LTV  
Amino Acid Sequences MPTKKWIDKKTATNYQLRYRAQTDPLIHDDQASDLVFTQVAAPNSTPSTTASSSSSSKIKTASTFSQELSLSPSSLRENEGEAAMHGVYYDDTEYDYMQHMRDINDSQVYFVDAQDGKNKKKEKMKLEEALKLPQEVLPSGAEVKRTYQDMQDVPDALSGFQPDMDPRLREVLEALEDEAYVDDDEDVFGELAKGGEVSLGEFEEEEDGWESDVTEKAPPPNNSHPPHGGKEEEEEEDWQKAFKSFKKDQKKGKVTFDNDSLADTMSFGGTMSVSNRSLRRKKKAGTESSGYSMSSSALFRTEGLTLLDDRFDKIEEEYAKDDEDEEEDMRSNSGVALPETRHDLDSVLDEFLEGYSVGKKGRVRRGKYGSGIEQLDEIRRGLGGARITSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.75
3 0.76
4 0.68
5 0.65
6 0.58
7 0.58
8 0.54
9 0.54
10 0.49
11 0.46
12 0.5
13 0.47
14 0.43
15 0.38
16 0.34
17 0.27
18 0.26
19 0.2
20 0.14
21 0.11
22 0.12
23 0.11
24 0.1
25 0.12
26 0.13
27 0.14
28 0.15
29 0.15
30 0.17
31 0.19
32 0.19
33 0.17
34 0.15
35 0.2
36 0.19
37 0.21
38 0.2
39 0.23
40 0.25
41 0.27
42 0.3
43 0.25
44 0.26
45 0.26
46 0.27
47 0.26
48 0.3
49 0.33
50 0.34
51 0.35
52 0.34
53 0.36
54 0.33
55 0.3
56 0.29
57 0.24
58 0.19
59 0.17
60 0.19
61 0.17
62 0.18
63 0.2
64 0.15
65 0.17
66 0.18
67 0.18
68 0.16
69 0.14
70 0.14
71 0.12
72 0.1
73 0.08
74 0.07
75 0.06
76 0.06
77 0.06
78 0.05
79 0.06
80 0.07
81 0.07
82 0.08
83 0.1
84 0.11
85 0.11
86 0.13
87 0.14
88 0.14
89 0.17
90 0.18
91 0.18
92 0.21
93 0.2
94 0.19
95 0.17
96 0.18
97 0.15
98 0.13
99 0.17
100 0.13
101 0.14
102 0.22
103 0.27
104 0.29
105 0.35
106 0.4
107 0.41
108 0.5
109 0.57
110 0.59
111 0.63
112 0.68
113 0.69
114 0.69
115 0.7
116 0.63
117 0.6
118 0.51
119 0.41
120 0.33
121 0.26
122 0.22
123 0.15
124 0.14
125 0.1
126 0.1
127 0.12
128 0.12
129 0.12
130 0.12
131 0.14
132 0.14
133 0.16
134 0.17
135 0.16
136 0.2
137 0.19
138 0.22
139 0.21
140 0.2
141 0.18
142 0.18
143 0.17
144 0.12
145 0.12
146 0.09
147 0.08
148 0.07
149 0.07
150 0.06
151 0.09
152 0.11
153 0.11
154 0.11
155 0.15
156 0.14
157 0.14
158 0.14
159 0.12
160 0.11
161 0.11
162 0.1
163 0.07
164 0.07
165 0.07
166 0.06
167 0.05
168 0.04
169 0.04
170 0.03
171 0.03
172 0.03
173 0.03
174 0.04
175 0.03
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.05
195 0.05
196 0.05
197 0.05
198 0.05
199 0.06
200 0.07
201 0.07
202 0.07
203 0.08
204 0.12
205 0.19
206 0.21
207 0.27
208 0.35
209 0.43
210 0.45
211 0.48
212 0.5
213 0.47
214 0.48
215 0.44
216 0.37
217 0.29
218 0.29
219 0.27
220 0.23
221 0.19
222 0.18
223 0.17
224 0.17
225 0.16
226 0.13
227 0.11
228 0.13
229 0.16
230 0.18
231 0.26
232 0.33
233 0.43
234 0.54
235 0.61
236 0.69
237 0.76
238 0.82
239 0.79
240 0.8
241 0.79
242 0.72
243 0.69
244 0.62
245 0.53
246 0.44
247 0.39
248 0.29
249 0.21
250 0.16
251 0.12
252 0.09
253 0.06
254 0.06
255 0.05
256 0.04
257 0.04
258 0.05
259 0.06
260 0.09
261 0.1
262 0.14
263 0.18
264 0.28
265 0.37
266 0.45
267 0.54
268 0.59
269 0.64
270 0.71
271 0.77
272 0.76
273 0.74
274 0.7
275 0.64
276 0.58
277 0.54
278 0.43
279 0.33
280 0.25
281 0.18
282 0.14
283 0.12
284 0.09
285 0.09
286 0.09
287 0.09
288 0.11
289 0.11
290 0.1
291 0.11
292 0.12
293 0.12
294 0.12
295 0.14
296 0.13
297 0.13
298 0.13
299 0.13
300 0.12
301 0.12
302 0.18
303 0.18
304 0.21
305 0.22
306 0.23
307 0.22
308 0.21
309 0.21
310 0.16
311 0.16
312 0.14
313 0.12
314 0.13
315 0.13
316 0.13
317 0.13
318 0.12
319 0.1
320 0.08
321 0.1
322 0.11
323 0.11
324 0.14
325 0.15
326 0.16
327 0.22
328 0.23
329 0.21
330 0.2
331 0.19
332 0.16
333 0.19
334 0.19
335 0.14
336 0.12
337 0.12
338 0.12
339 0.11
340 0.1
341 0.07
342 0.06
343 0.08
344 0.1
345 0.11
346 0.16
347 0.21
348 0.29
349 0.4
350 0.5
351 0.54
352 0.63
353 0.71
354 0.75
355 0.77
356 0.76
357 0.7
358 0.68
359 0.62
360 0.52
361 0.46
362 0.39
363 0.36
364 0.29
365 0.24
366 0.17
367 0.16
368 0.16
369 0.14
370 0.17
371 0.17