Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JI47

Protein Details
Accession A0A3N4JI47   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
61-91NSNEKVKKGEANKKKKRKKKEKMENVTMEIMHydrophilic
NLS Segment(s)
PositionSequence
65-82KVKKGEANKKKKRKKKEK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
Amino Acid Sequences MNMNTLRYPKLHSIESKLTAMGHTIWYIETTVKNHKTKINNNSTRMKDNQNQGIGTSSSQNSNEKVKKGEANKKKKRKKKEKMENVTMEIMENSELKVEKTPSIKEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.45
4 0.38
5 0.34
6 0.29
7 0.26
8 0.2
9 0.14
10 0.1
11 0.1
12 0.09
13 0.09
14 0.1
15 0.1
16 0.11
17 0.13
18 0.22
19 0.29
20 0.31
21 0.33
22 0.39
23 0.46
24 0.52
25 0.59
26 0.62
27 0.61
28 0.65
29 0.7
30 0.67
31 0.63
32 0.58
33 0.54
34 0.48
35 0.46
36 0.46
37 0.4
38 0.37
39 0.33
40 0.31
41 0.25
42 0.2
43 0.16
44 0.11
45 0.11
46 0.12
47 0.13
48 0.14
49 0.21
50 0.24
51 0.24
52 0.26
53 0.27
54 0.32
55 0.39
56 0.48
57 0.5
58 0.59
59 0.67
60 0.76
61 0.84
62 0.87
63 0.9
64 0.91
65 0.92
66 0.92
67 0.93
68 0.93
69 0.93
70 0.94
71 0.88
72 0.81
73 0.72
74 0.61
75 0.5
76 0.39
77 0.29
78 0.2
79 0.14
80 0.1
81 0.1
82 0.1
83 0.11
84 0.15
85 0.17
86 0.21
87 0.25