Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JW63

Protein Details
Accession A0A3N4JW63    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
96-129QSKKARGKGAPKKKKEGNDKKKKARIMRGGQEGYBasic
NLS Segment(s)
PositionSequence
98-124KKARGKGAPKKKKEGNDKKKKARIMRG
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MATAISRIVKLLPTKALPPRERLQELARTTSRIFSTTYNPQNLRTGNRVLRERLRGPALLDYYQPGRRVGVVDLRRHFPMMSFVDEQERQRLLDVQSKKARGKGAPKKKKEGNDKKKKARIMRGGQEGYVRARL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.38
3 0.46
4 0.45
5 0.48
6 0.51
7 0.54
8 0.55
9 0.52
10 0.5
11 0.49
12 0.49
13 0.5
14 0.45
15 0.39
16 0.37
17 0.38
18 0.33
19 0.26
20 0.25
21 0.2
22 0.24
23 0.3
24 0.36
25 0.38
26 0.38
27 0.39
28 0.42
29 0.42
30 0.4
31 0.35
32 0.36
33 0.33
34 0.38
35 0.39
36 0.38
37 0.41
38 0.43
39 0.41
40 0.39
41 0.37
42 0.32
43 0.3
44 0.29
45 0.26
46 0.21
47 0.19
48 0.17
49 0.18
50 0.19
51 0.19
52 0.15
53 0.13
54 0.13
55 0.14
56 0.14
57 0.18
58 0.21
59 0.26
60 0.27
61 0.29
62 0.29
63 0.29
64 0.28
65 0.2
66 0.22
67 0.18
68 0.2
69 0.19
70 0.19
71 0.23
72 0.25
73 0.26
74 0.24
75 0.22
76 0.18
77 0.18
78 0.21
79 0.19
80 0.25
81 0.27
82 0.32
83 0.38
84 0.43
85 0.44
86 0.45
87 0.47
88 0.45
89 0.52
90 0.55
91 0.6
92 0.65
93 0.7
94 0.76
95 0.79
96 0.82
97 0.83
98 0.84
99 0.84
100 0.85
101 0.88
102 0.89
103 0.9
104 0.9
105 0.88
106 0.87
107 0.86
108 0.85
109 0.84
110 0.83
111 0.77
112 0.69
113 0.63
114 0.55