Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4K0W2

Protein Details
Accession A0A3N4K0W2    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-85AASAQTTPRKRTPRKRKKVQDNAKNKSLHydrophilic
NLS Segment(s)
PositionSequence
65-77PRKRTPRKRKKVQ
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MKLIETHDVSVKPQNIQEAWPKDGREVPTARAISERIAKIRNSVKVTAASDAGLPPPAASAQTTPRKRTPRKRKKVQDNAKNKSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.29
4 0.36
5 0.33
6 0.35
7 0.36
8 0.35
9 0.32
10 0.36
11 0.36
12 0.33
13 0.3
14 0.28
15 0.32
16 0.32
17 0.3
18 0.27
19 0.25
20 0.21
21 0.25
22 0.24
23 0.19
24 0.21
25 0.21
26 0.24
27 0.28
28 0.31
29 0.29
30 0.28
31 0.28
32 0.28
33 0.29
34 0.25
35 0.2
36 0.15
37 0.12
38 0.12
39 0.11
40 0.08
41 0.07
42 0.06
43 0.06
44 0.06
45 0.06
46 0.07
47 0.09
48 0.16
49 0.26
50 0.32
51 0.36
52 0.45
53 0.55
54 0.64
55 0.73
56 0.77
57 0.79
58 0.85
59 0.91
60 0.94
61 0.95
62 0.96
63 0.96
64 0.95
65 0.95