Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4IWX1

Protein Details
Accession A0A3N4IWX1   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
24-45IASTLKSKKPPPRPIGKIKDESHydrophilic
NLS Segment(s)
PositionSequence
31-36KKPPPR
Subcellular Location(s) cyto 15.5, cyto_nucl 10, nucl 3.5, mito 3, pero 3
Family & Domain DBs
Amino Acid Sequences MMDEDEFPALALSTKENVVALLLIASTLKSKKPPPRPIGKIKDESLEAAKLELACPIQAKGKAVLPSVNTTATAVSSSGPHTISLAIVTSSTASYEGTTPIFSNISCAFDCHKCHQAGSKDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.1
5 0.1
6 0.09
7 0.07
8 0.05
9 0.05
10 0.04
11 0.04
12 0.05
13 0.07
14 0.08
15 0.1
16 0.14
17 0.23
18 0.32
19 0.43
20 0.53
21 0.59
22 0.68
23 0.75
24 0.81
25 0.82
26 0.8
27 0.75
28 0.66
29 0.6
30 0.5
31 0.44
32 0.35
33 0.27
34 0.19
35 0.14
36 0.13
37 0.1
38 0.1
39 0.09
40 0.07
41 0.06
42 0.07
43 0.07
44 0.1
45 0.1
46 0.11
47 0.12
48 0.15
49 0.16
50 0.16
51 0.17
52 0.15
53 0.17
54 0.17
55 0.16
56 0.13
57 0.11
58 0.11
59 0.09
60 0.08
61 0.06
62 0.05
63 0.06
64 0.07
65 0.08
66 0.09
67 0.08
68 0.08
69 0.08
70 0.08
71 0.08
72 0.07
73 0.06
74 0.05
75 0.05
76 0.06
77 0.05
78 0.06
79 0.06
80 0.06
81 0.06
82 0.07
83 0.08
84 0.09
85 0.1
86 0.1
87 0.11
88 0.12
89 0.1
90 0.14
91 0.14
92 0.17
93 0.16
94 0.17
95 0.2
96 0.25
97 0.3
98 0.32
99 0.38
100 0.36
101 0.38
102 0.45