Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JD95

Protein Details
Accession A0A3N4JD95   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
43-68LAYNSHYHRRRHKRTWRETQCSKLRIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, mito 4, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MEITQYKNRVRRVNQSSSVKELSLSILEMTKIEFLDAPIRINLAYNSHYHRRRHKRTWRETQCSKLRISCHPGGSNSHLRESFSAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.74
3 0.7
4 0.67
5 0.63
6 0.52
7 0.44
8 0.35
9 0.27
10 0.19
11 0.16
12 0.1
13 0.09
14 0.09
15 0.09
16 0.08
17 0.08
18 0.07
19 0.07
20 0.06
21 0.07
22 0.1
23 0.11
24 0.11
25 0.1
26 0.1
27 0.1
28 0.1
29 0.1
30 0.08
31 0.09
32 0.1
33 0.15
34 0.23
35 0.29
36 0.34
37 0.44
38 0.53
39 0.61
40 0.7
41 0.76
42 0.8
43 0.84
44 0.9
45 0.9
46 0.89
47 0.86
48 0.85
49 0.83
50 0.75
51 0.68
52 0.61
53 0.54
54 0.52
55 0.54
56 0.5
57 0.47
58 0.47
59 0.47
60 0.47
61 0.5
62 0.52
63 0.47
64 0.47
65 0.42
66 0.4