Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JAF0

Protein Details
Accession A0A3N4JAF0    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
96-126GEATKIEKASRQQRKQRKNRGKESRGTAKTKHydrophilic
NLS Segment(s)
PositionSequence
102-133EKASRQQRKQRKNRGKESRGTAKTKASKDKKK
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSDSQVTLRTRKFIRNALLGRKQMVVDVLHPNKPNVSKDDLRNRLAELYKADKNQVSVFGFRTQYGGGKSTGFALIYDSYEALKKFEPHYRLVRFGEATKIEKASRQQRKQRKNRGKESRGTAKTKASKDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.6
4 0.63
5 0.67
6 0.62
7 0.57
8 0.52
9 0.45
10 0.36
11 0.32
12 0.24
13 0.19
14 0.26
15 0.28
16 0.31
17 0.32
18 0.32
19 0.33
20 0.36
21 0.35
22 0.29
23 0.33
24 0.33
25 0.41
26 0.51
27 0.53
28 0.51
29 0.49
30 0.46
31 0.44
32 0.39
33 0.33
34 0.25
35 0.25
36 0.26
37 0.26
38 0.27
39 0.23
40 0.24
41 0.23
42 0.23
43 0.19
44 0.17
45 0.18
46 0.2
47 0.19
48 0.18
49 0.18
50 0.14
51 0.15
52 0.14
53 0.14
54 0.11
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.07
61 0.08
62 0.08
63 0.08
64 0.08
65 0.07
66 0.07
67 0.09
68 0.09
69 0.09
70 0.1
71 0.12
72 0.15
73 0.21
74 0.23
75 0.27
76 0.35
77 0.37
78 0.41
79 0.41
80 0.41
81 0.36
82 0.34
83 0.35
84 0.3
85 0.29
86 0.26
87 0.27
88 0.24
89 0.26
90 0.33
91 0.38
92 0.46
93 0.53
94 0.61
95 0.69
96 0.8
97 0.87
98 0.91
99 0.92
100 0.92
101 0.93
102 0.94
103 0.92
104 0.89
105 0.88
106 0.87
107 0.84
108 0.79
109 0.72
110 0.71
111 0.71
112 0.7
113 0.72