Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K3U0

Protein Details
Accession A0A3N4K3U0    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
41-61GVYKNKPTKYRQYMNRPGGFNHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.5, cyto 10.5, nucl 9.5, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences ADGEAMEGVMDDEEAQMRAMMGFGGFGTTKQKKVRGNDVGGVYKNKPTKYRQYMNRPGGFNRALSPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.06
6 0.05
7 0.05
8 0.04
9 0.04
10 0.03
11 0.04
12 0.04
13 0.05
14 0.12
15 0.14
16 0.18
17 0.21
18 0.27
19 0.31
20 0.35
21 0.44
22 0.44
23 0.45
24 0.45
25 0.45
26 0.43
27 0.39
28 0.39
29 0.3
30 0.3
31 0.31
32 0.3
33 0.31
34 0.34
35 0.43
36 0.5
37 0.58
38 0.63
39 0.7
40 0.78
41 0.82
42 0.83
43 0.75
44 0.68
45 0.66
46 0.58
47 0.49