Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K3E4

Protein Details
Accession A0A3N4K3E4    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
50-75FSLLVKMNKTNRKKNIKKPMGFWRPRHydrophilic
NLS Segment(s)
PositionSequence
61-68RKKNIKKP
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MHPSLPWRGRIYILPTGLISLIQQTSIKPATHPDNTLDYRMFYLFFGIPFSLLVKMNKTNRKKNIKKPMGFWRPRPTQAQPVGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.27
4 0.24
5 0.2
6 0.14
7 0.09
8 0.08
9 0.08
10 0.09
11 0.08
12 0.12
13 0.15
14 0.15
15 0.13
16 0.17
17 0.22
18 0.24
19 0.26
20 0.24
21 0.28
22 0.29
23 0.3
24 0.26
25 0.21
26 0.19
27 0.18
28 0.16
29 0.09
30 0.1
31 0.08
32 0.08
33 0.09
34 0.07
35 0.07
36 0.07
37 0.08
38 0.08
39 0.09
40 0.1
41 0.12
42 0.18
43 0.26
44 0.35
45 0.43
46 0.51
47 0.59
48 0.69
49 0.76
50 0.81
51 0.84
52 0.86
53 0.83
54 0.81
55 0.82
56 0.82
57 0.8
58 0.78
59 0.76
60 0.74
61 0.74
62 0.73
63 0.69
64 0.68