Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4K716

Protein Details
Accession A0A3N4K716    Localization Confidence High Confidence Score 22.5
NoLS Segment(s)
PositionSequenceProtein Nature
279-304EDEDIRPKPKRRVKEKPKEEEEKEAEAcidic
330-355LVTEGGRRRGRRKVNKKVQVKDEDGYBasic
368-397SEEEPAPKPKPKPKPAPKGKKKNAGPAPGQBasic
NLS Segment(s)
PositionSequence
284-296RPKPKRRVKEKPK
335-346GRRRGRRKVNKK
374-392PKPKPKPKPAPKGKKKNAG
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019038  POLD3  
IPR041913  POLD3_sf  
Gene Ontology GO:0043625  C:delta DNA polymerase complex  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF09507  CDC27  
Amino Acid Sequences MLYEFHDSRKKKGDVYATYIITGERKEVIQEAGDDVDEDEDMSGSPFEVTPREKKEEKFRYQKIVKLVGEERLEEVKAEIENIKTIHIYSLGPSRIKDLSVLSTCSDKVRTEFIYEDEQAAGRAYGMIVNRMAIKTPRPFRPFPPRHVVHAPAAPKVDETKANPDAKNKAKLLPETKTEKKSTPAQMKRSQSATKAAQKNPGQSNLFTSWGNVANKKAESDSSSAAHSPKNEEEPVRMDIDSEDEDDFKPNLLRDAAEDARKRRERDAELTKMMEMSDEDEDIRPKPKRRVKEKPKEEEEKEAEEEEEEEAQETPEKKPVELPAGSVVNLVTEGGRRRGRRKVNKKVQVKDEDGYLVTKFEPAWESFSEEEPAPKPKPKPKPAPKGKKKNAGPAPGQGDIGSYFFKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.62
3 0.63
4 0.54
5 0.51
6 0.47
7 0.4
8 0.33
9 0.27
10 0.2
11 0.15
12 0.14
13 0.15
14 0.17
15 0.17
16 0.17
17 0.17
18 0.17
19 0.16
20 0.16
21 0.14
22 0.13
23 0.11
24 0.09
25 0.09
26 0.07
27 0.06
28 0.06
29 0.07
30 0.06
31 0.06
32 0.07
33 0.07
34 0.08
35 0.13
36 0.18
37 0.25
38 0.32
39 0.38
40 0.43
41 0.48
42 0.58
43 0.64
44 0.7
45 0.72
46 0.72
47 0.76
48 0.76
49 0.75
50 0.72
51 0.71
52 0.61
53 0.57
54 0.53
55 0.49
56 0.45
57 0.41
58 0.36
59 0.29
60 0.28
61 0.22
62 0.19
63 0.15
64 0.13
65 0.14
66 0.14
67 0.12
68 0.15
69 0.15
70 0.15
71 0.13
72 0.14
73 0.13
74 0.12
75 0.12
76 0.11
77 0.18
78 0.21
79 0.22
80 0.22
81 0.24
82 0.24
83 0.24
84 0.23
85 0.18
86 0.21
87 0.21
88 0.23
89 0.2
90 0.21
91 0.22
92 0.22
93 0.22
94 0.17
95 0.17
96 0.19
97 0.2
98 0.21
99 0.21
100 0.22
101 0.25
102 0.25
103 0.24
104 0.2
105 0.18
106 0.16
107 0.15
108 0.12
109 0.07
110 0.06
111 0.05
112 0.07
113 0.07
114 0.09
115 0.08
116 0.09
117 0.11
118 0.11
119 0.12
120 0.12
121 0.16
122 0.23
123 0.3
124 0.38
125 0.42
126 0.45
127 0.51
128 0.61
129 0.62
130 0.61
131 0.64
132 0.58
133 0.58
134 0.6
135 0.56
136 0.47
137 0.46
138 0.41
139 0.33
140 0.31
141 0.25
142 0.21
143 0.2
144 0.18
145 0.17
146 0.18
147 0.22
148 0.28
149 0.33
150 0.33
151 0.36
152 0.41
153 0.44
154 0.48
155 0.42
156 0.4
157 0.39
158 0.44
159 0.45
160 0.41
161 0.41
162 0.42
163 0.46
164 0.47
165 0.46
166 0.42
167 0.41
168 0.45
169 0.48
170 0.51
171 0.52
172 0.55
173 0.6
174 0.62
175 0.61
176 0.59
177 0.52
178 0.44
179 0.43
180 0.41
181 0.42
182 0.45
183 0.44
184 0.47
185 0.47
186 0.52
187 0.48
188 0.48
189 0.41
190 0.34
191 0.36
192 0.29
193 0.29
194 0.22
195 0.19
196 0.16
197 0.19
198 0.2
199 0.17
200 0.17
201 0.18
202 0.18
203 0.18
204 0.17
205 0.13
206 0.14
207 0.15
208 0.16
209 0.14
210 0.15
211 0.15
212 0.16
213 0.16
214 0.15
215 0.16
216 0.15
217 0.18
218 0.19
219 0.19
220 0.2
221 0.22
222 0.23
223 0.21
224 0.19
225 0.16
226 0.14
227 0.16
228 0.14
229 0.12
230 0.11
231 0.1
232 0.1
233 0.12
234 0.12
235 0.11
236 0.11
237 0.1
238 0.11
239 0.11
240 0.11
241 0.1
242 0.16
243 0.18
244 0.23
245 0.27
246 0.28
247 0.37
248 0.43
249 0.43
250 0.43
251 0.48
252 0.48
253 0.53
254 0.59
255 0.55
256 0.53
257 0.52
258 0.46
259 0.38
260 0.33
261 0.24
262 0.15
263 0.11
264 0.09
265 0.09
266 0.09
267 0.1
268 0.12
269 0.13
270 0.19
271 0.23
272 0.28
273 0.38
274 0.45
275 0.54
276 0.63
277 0.73
278 0.78
279 0.84
280 0.88
281 0.89
282 0.9
283 0.89
284 0.82
285 0.8
286 0.73
287 0.66
288 0.58
289 0.48
290 0.39
291 0.3
292 0.27
293 0.19
294 0.15
295 0.1
296 0.09
297 0.08
298 0.09
299 0.13
300 0.13
301 0.13
302 0.19
303 0.2
304 0.19
305 0.23
306 0.27
307 0.3
308 0.29
309 0.29
310 0.29
311 0.29
312 0.29
313 0.25
314 0.21
315 0.14
316 0.13
317 0.12
318 0.06
319 0.09
320 0.12
321 0.18
322 0.25
323 0.3
324 0.36
325 0.46
326 0.56
327 0.65
328 0.73
329 0.77
330 0.82
331 0.87
332 0.91
333 0.9
334 0.89
335 0.87
336 0.81
337 0.7
338 0.62
339 0.54
340 0.45
341 0.38
342 0.28
343 0.2
344 0.15
345 0.15
346 0.12
347 0.13
348 0.15
349 0.15
350 0.19
351 0.19
352 0.23
353 0.23
354 0.26
355 0.26
356 0.23
357 0.25
358 0.24
359 0.3
360 0.3
361 0.36
362 0.42
363 0.5
364 0.6
365 0.67
366 0.76
367 0.8
368 0.87
369 0.91
370 0.94
371 0.95
372 0.96
373 0.95
374 0.95
375 0.91
376 0.91
377 0.89
378 0.86
379 0.8
380 0.77
381 0.73
382 0.64
383 0.57
384 0.46
385 0.38
386 0.3
387 0.27