Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JI14

Protein Details
Accession A0A3N4JI14   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKRKKMKMKKEPYPHFHVHPBasic
NLS Segment(s)
PositionSequence
3-9RKKMKMK
52-56KKKKI
Subcellular Location(s) nucl 16, mito_nucl 12.833, cyto_nucl 9.333, mito 8.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKRKKMKMKKEPYPHFHVHPSSTPQTIIPLMQTFPYKKNSILRLANSNEQGKKKKITPPKSPIVRQEIRGSRGEQQAKYMVTFSFFFFSYFPILDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.74
3 0.7
4 0.64
5 0.57
6 0.51
7 0.5
8 0.45
9 0.41
10 0.37
11 0.3
12 0.28
13 0.25
14 0.21
15 0.16
16 0.13
17 0.12
18 0.13
19 0.17
20 0.16
21 0.18
22 0.23
23 0.22
24 0.24
25 0.3
26 0.31
27 0.35
28 0.37
29 0.36
30 0.38
31 0.39
32 0.4
33 0.37
34 0.37
35 0.34
36 0.35
37 0.37
38 0.33
39 0.34
40 0.36
41 0.41
42 0.47
43 0.52
44 0.58
45 0.61
46 0.68
47 0.72
48 0.71
49 0.7
50 0.69
51 0.63
52 0.56
53 0.58
54 0.54
55 0.5
56 0.48
57 0.44
58 0.41
59 0.47
60 0.49
61 0.4
62 0.38
63 0.39
64 0.37
65 0.36
66 0.3
67 0.22
68 0.19
69 0.2
70 0.18
71 0.15
72 0.15
73 0.15
74 0.14
75 0.15
76 0.16