Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JKH7

Protein Details
Accession A0A3N4JKH7   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MHKLCQLRARKKGKKNKRRTGKVKENKFSFHBasic
NLS Segment(s)
PositionSequence
8-39RARKKGKKNKRRTGKVKENKFSFHIKAWLRRK
Subcellular Location(s) nucl 13mito_nucl 13, mito 11
Family & Domain DBs
Amino Acid Sequences MHKLCQLRARKKGKKNKRRTGKVKENKFSFHIKAWLRRKLLEVKQQMRRRAALRFCNWALTCIHICNILRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.93
4 0.93
5 0.94
6 0.94
7 0.94
8 0.94
9 0.93
10 0.92
11 0.9
12 0.82
13 0.75
14 0.67
15 0.62
16 0.53
17 0.45
18 0.42
19 0.37
20 0.42
21 0.46
22 0.5
23 0.45
24 0.44
25 0.45
26 0.47
27 0.5
28 0.5
29 0.52
30 0.53
31 0.61
32 0.67
33 0.69
34 0.64
35 0.61
36 0.55
37 0.54
38 0.54
39 0.54
40 0.52
41 0.53
42 0.5
43 0.54
44 0.51
45 0.45
46 0.37
47 0.34
48 0.32
49 0.26
50 0.26
51 0.23