Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JJW9

Protein Details
Accession A0A3N4JJW9    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
39-67VPPPHPPKVIVPKKKKKKKLSYSTLPFTTHydrophilic
NLS Segment(s)
PositionSequence
45-57PKVIVPKKKKKKK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, mito 4
Family & Domain DBs
Amino Acid Sequences MTPTTNLAAQGTFPEPTISLTPRATKAQSPTNLTQYSTVPPPHPPKVIVPKKKKKKKLSYSTLPFTTSTRNSNKPTPNQIKSNPPITPVSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.15
4 0.18
5 0.16
6 0.18
7 0.2
8 0.23
9 0.25
10 0.28
11 0.27
12 0.27
13 0.3
14 0.35
15 0.37
16 0.4
17 0.4
18 0.43
19 0.42
20 0.39
21 0.36
22 0.29
23 0.27
24 0.24
25 0.22
26 0.17
27 0.22
28 0.27
29 0.29
30 0.29
31 0.28
32 0.3
33 0.39
34 0.48
35 0.52
36 0.57
37 0.64
38 0.74
39 0.83
40 0.88
41 0.88
42 0.89
43 0.9
44 0.9
45 0.9
46 0.89
47 0.88
48 0.84
49 0.75
50 0.66
51 0.56
52 0.46
53 0.42
54 0.35
55 0.34
56 0.34
57 0.39
58 0.42
59 0.49
60 0.56
61 0.58
62 0.66
63 0.69
64 0.69
65 0.7
66 0.7
67 0.72
68 0.69
69 0.69
70 0.59
71 0.53