Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K1M6

Protein Details
Accession A0A3N4K1M6    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-24TLQAKKPQTSKQLKPPKTNEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MDKVTLQAKKPQTSKQLKPPKTNEIHYKVNPRTAIIQVKRLLNPRTVSEYSTIPPSRYYDTVLTRITDEAQLKLSGEERETPGGRNPKRTGLTPAPTPSTFRKLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.73
3 0.76
4 0.76
5 0.81
6 0.8
7 0.79
8 0.76
9 0.75
10 0.74
11 0.7
12 0.7
13 0.65
14 0.69
15 0.61
16 0.6
17 0.53
18 0.45
19 0.42
20 0.39
21 0.43
22 0.35
23 0.38
24 0.36
25 0.39
26 0.4
27 0.43
28 0.4
29 0.35
30 0.35
31 0.3
32 0.34
33 0.32
34 0.29
35 0.25
36 0.25
37 0.21
38 0.26
39 0.24
40 0.17
41 0.17
42 0.18
43 0.19
44 0.19
45 0.21
46 0.18
47 0.21
48 0.24
49 0.24
50 0.22
51 0.2
52 0.2
53 0.18
54 0.18
55 0.16
56 0.13
57 0.14
58 0.14
59 0.14
60 0.14
61 0.15
62 0.12
63 0.13
64 0.15
65 0.15
66 0.2
67 0.21
68 0.22
69 0.27
70 0.36
71 0.38
72 0.44
73 0.44
74 0.48
75 0.5
76 0.51
77 0.53
78 0.52
79 0.54
80 0.52
81 0.54
82 0.51
83 0.49
84 0.51
85 0.48