Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JM77

Protein Details
Accession A0A3N4JM77    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-34FPPITRIPRGRPKRERIPPGEBasic
NLS Segment(s)
PositionSequence
21-33PRGRPKRERIPPG
Subcellular Location(s) nucl 15, cyto_nucl 13, cyto 7, mito 2, extr 2
Family & Domain DBs
Amino Acid Sequences MPLDITNLVPGDIFPPITRIPRGRPKRERIPPGEVRNRARVHQLTSGLPLVPDRTPHHCSTGGQEGHNARACKKPRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.11
3 0.13
4 0.16
5 0.2
6 0.22
7 0.3
8 0.4
9 0.49
10 0.57
11 0.64
12 0.7
13 0.76
14 0.82
15 0.83
16 0.79
17 0.78
18 0.76
19 0.76
20 0.76
21 0.71
22 0.65
23 0.64
24 0.59
25 0.51
26 0.48
27 0.41
28 0.35
29 0.33
30 0.32
31 0.25
32 0.26
33 0.26
34 0.2
35 0.18
36 0.15
37 0.13
38 0.11
39 0.14
40 0.15
41 0.21
42 0.26
43 0.28
44 0.31
45 0.31
46 0.32
47 0.34
48 0.4
49 0.36
50 0.31
51 0.36
52 0.33
53 0.38
54 0.43
55 0.38
56 0.31
57 0.38