Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4K8C1

Protein Details
Accession A0A3N4K8C1    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-29TRNHRSLKTQGGRKKKNPRLPCLPGLHydrophilic
NLS Segment(s)
PositionSequence
15-19GRKKK
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MPLTRNHRSLKTQGGRKKKNPRLPCLPGLRPLVSYDPSLPSNYFHSLDNPNTYCAMVVIAEPNEEIHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.79
4 0.85
5 0.84
6 0.85
7 0.85
8 0.84
9 0.83
10 0.8
11 0.78
12 0.75
13 0.67
14 0.63
15 0.58
16 0.5
17 0.41
18 0.36
19 0.3
20 0.23
21 0.22
22 0.17
23 0.15
24 0.15
25 0.16
26 0.15
27 0.14
28 0.16
29 0.18
30 0.18
31 0.16
32 0.19
33 0.22
34 0.25
35 0.3
36 0.27
37 0.26
38 0.26
39 0.25
40 0.21
41 0.17
42 0.15
43 0.09
44 0.08
45 0.1
46 0.1
47 0.1
48 0.11