Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4K6U9

Protein Details
Accession A0A3N4K6U9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
2-23ATDAGIRRPRTRRQHLFVKELKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003195  TFIID_TAF13  
Gene Ontology GO:0005634  C:nucleus  
GO:0046982  F:protein heterodimerization activity  
GO:0006366  P:transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF02269  TFIID-18kDa  
CDD cd07978  TAF13  
Amino Acid Sequences MATDAGIRRPRTRRQHLFVKELKSLMYAFGDDPDPLPESVQVLDEIVTDYIVDMCHDAARMASRGGRNKIKVDDFKFALRKDQRKLGRVEELLVMSKVIAEARKQFDDKQEVNDVAGGASGAGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.8
3 0.79
4 0.82
5 0.78
6 0.73
7 0.66
8 0.56
9 0.49
10 0.39
11 0.33
12 0.25
13 0.19
14 0.14
15 0.11
16 0.12
17 0.12
18 0.11
19 0.11
20 0.11
21 0.12
22 0.11
23 0.11
24 0.1
25 0.1
26 0.1
27 0.1
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.06
34 0.05
35 0.04
36 0.04
37 0.05
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.04
45 0.04
46 0.06
47 0.06
48 0.06
49 0.09
50 0.12
51 0.17
52 0.23
53 0.27
54 0.28
55 0.31
56 0.34
57 0.37
58 0.4
59 0.39
60 0.39
61 0.36
62 0.39
63 0.41
64 0.37
65 0.41
66 0.42
67 0.44
68 0.44
69 0.51
70 0.51
71 0.53
72 0.56
73 0.52
74 0.52
75 0.46
76 0.44
77 0.37
78 0.32
79 0.28
80 0.24
81 0.19
82 0.11
83 0.11
84 0.09
85 0.09
86 0.09
87 0.1
88 0.16
89 0.22
90 0.26
91 0.29
92 0.31
93 0.37
94 0.45
95 0.44
96 0.43
97 0.44
98 0.4
99 0.39
100 0.37
101 0.29
102 0.21
103 0.19
104 0.13
105 0.06