Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4IUW9

Protein Details
Accession A0A3N4IUW9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-41IDEYRYKYLRKQKHERCRNKLETRELHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MVIPKVKKHPPLGKIIDEYRYKYLRKQKHERCRNKLETRELLEKSREVQLTKGRVNKCPRKYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.57
3 0.55
4 0.49
5 0.47
6 0.43
7 0.42
8 0.38
9 0.4
10 0.46
11 0.48
12 0.55
13 0.62
14 0.67
15 0.74
16 0.84
17 0.87
18 0.86
19 0.87
20 0.87
21 0.84
22 0.81
23 0.77
24 0.72
25 0.67
26 0.66
27 0.58
28 0.52
29 0.46
30 0.4
31 0.34
32 0.34
33 0.31
34 0.25
35 0.28
36 0.32
37 0.37
38 0.42
39 0.48
40 0.46
41 0.52
42 0.62
43 0.67