Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3N4JNK5

Protein Details
Accession A0A3N4JNK5   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
206-229SVNSRGSVKKKPKPPPPKQEFTSDHydrophilic
NLS Segment(s)
PositionSequence
214-222KKKPKPPPP
263-274KKFFGKKKAPGR
Subcellular Location(s) nucl 15, cyto 9.5, cyto_mito 6.5
Family & Domain DBs
Amino Acid Sequences METLLAADLAPATLSSQGGTQGLPLGSQRNVQRKDSTLELVSDINPLEGEDLSGDWWKVQGPPEELYISGDNPSSEKLKNEVKKWVQEVRNTCPLIMDGCDAPEVVVVDPPAYEQTGPSSPCLPTMYEENPAELHNIFPTTVIFGDEKYPVPPSGPISVNRTSTTQSHTHARRISTSSSVARSSTFSGSHVAGMDNRTIGSLEAISVNSRGSVKKKPKPPPPKQEFTSDGSLAYNAYFSPLPANNKVVTSQAPQVSARAEALKKFFGKKKAPGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.09
5 0.1
6 0.1
7 0.09
8 0.12
9 0.12
10 0.12
11 0.13
12 0.15
13 0.16
14 0.21
15 0.28
16 0.34
17 0.39
18 0.42
19 0.46
20 0.46
21 0.49
22 0.47
23 0.44
24 0.36
25 0.33
26 0.3
27 0.27
28 0.23
29 0.21
30 0.17
31 0.13
32 0.11
33 0.09
34 0.09
35 0.07
36 0.07
37 0.06
38 0.06
39 0.07
40 0.09
41 0.09
42 0.07
43 0.08
44 0.09
45 0.11
46 0.15
47 0.19
48 0.21
49 0.22
50 0.25
51 0.25
52 0.24
53 0.26
54 0.22
55 0.17
56 0.15
57 0.14
58 0.12
59 0.12
60 0.13
61 0.13
62 0.13
63 0.14
64 0.18
65 0.26
66 0.32
67 0.35
68 0.43
69 0.45
70 0.49
71 0.53
72 0.57
73 0.53
74 0.54
75 0.56
76 0.53
77 0.56
78 0.5
79 0.45
80 0.37
81 0.32
82 0.27
83 0.22
84 0.17
85 0.08
86 0.09
87 0.09
88 0.08
89 0.08
90 0.07
91 0.07
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.06
99 0.06
100 0.05
101 0.05
102 0.08
103 0.11
104 0.12
105 0.13
106 0.14
107 0.14
108 0.15
109 0.16
110 0.14
111 0.12
112 0.15
113 0.15
114 0.18
115 0.18
116 0.17
117 0.17
118 0.17
119 0.17
120 0.13
121 0.11
122 0.07
123 0.07
124 0.07
125 0.06
126 0.06
127 0.05
128 0.05
129 0.07
130 0.06
131 0.06
132 0.08
133 0.09
134 0.1
135 0.1
136 0.11
137 0.1
138 0.1
139 0.11
140 0.12
141 0.15
142 0.17
143 0.18
144 0.22
145 0.25
146 0.26
147 0.26
148 0.25
149 0.22
150 0.22
151 0.24
152 0.22
153 0.21
154 0.28
155 0.3
156 0.34
157 0.36
158 0.36
159 0.35
160 0.36
161 0.35
162 0.3
163 0.31
164 0.28
165 0.27
166 0.27
167 0.23
168 0.21
169 0.2
170 0.2
171 0.18
172 0.16
173 0.14
174 0.15
175 0.15
176 0.15
177 0.14
178 0.12
179 0.12
180 0.12
181 0.12
182 0.1
183 0.1
184 0.09
185 0.09
186 0.08
187 0.07
188 0.06
189 0.06
190 0.07
191 0.07
192 0.08
193 0.08
194 0.08
195 0.08
196 0.1
197 0.12
198 0.16
199 0.25
200 0.35
201 0.43
202 0.53
203 0.62
204 0.71
205 0.8
206 0.87
207 0.88
208 0.87
209 0.88
210 0.81
211 0.79
212 0.72
213 0.66
214 0.61
215 0.5
216 0.41
217 0.33
218 0.3
219 0.22
220 0.18
221 0.13
222 0.07
223 0.09
224 0.08
225 0.08
226 0.13
227 0.18
228 0.23
229 0.26
230 0.3
231 0.29
232 0.3
233 0.31
234 0.28
235 0.27
236 0.25
237 0.28
238 0.28
239 0.29
240 0.29
241 0.29
242 0.28
243 0.26
244 0.24
245 0.24
246 0.24
247 0.25
248 0.28
249 0.33
250 0.36
251 0.42
252 0.47
253 0.51
254 0.57