Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4JHB3

Protein Details
Accession A0A3N4JHB3    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
6-32KTIVGYRCVKPKKKTSPSVRKQPSETEHydrophilic
NLS Segment(s)
PositionSequence
92-123APRAPRTPRTPRTPRAPRAPRTPRTPRAPRTP
Subcellular Location(s) nucl 20, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006058  2Fe2S_fd_BS  
IPR001841  Znf_RING  
Gene Ontology GO:0051537  F:2 iron, 2 sulfur cluster binding  
PROSITE View protein in PROSITE  
PS00197  2FE2S_FER_1  
PS50089  ZF_RING_2  
Amino Acid Sequences MLDWAKTIVGYRCVKPKKKTSPSVRKQPSETETPMAPGVEVDTEPIIEPITEPIIEPITEPIIEPITEPITEPITEPITKPPTPPPVSPPQAPRAPRTPRTPRTPRAPRAPRTPRTPRAPRTPKTPTTPTHDEEDDSFKIPGPKTWEIPRDSPVVVQKAEDREKYMKRCLDCLERQGEIMLECGHGVCGQCFEEYGKSERCTGCKVLLGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.63
3 0.7
4 0.73
5 0.79
6 0.86
7 0.87
8 0.89
9 0.9
10 0.93
11 0.92
12 0.87
13 0.8
14 0.78
15 0.72
16 0.68
17 0.61
18 0.53
19 0.44
20 0.4
21 0.37
22 0.28
23 0.23
24 0.15
25 0.12
26 0.1
27 0.09
28 0.08
29 0.07
30 0.08
31 0.08
32 0.08
33 0.07
34 0.06
35 0.06
36 0.07
37 0.08
38 0.08
39 0.07
40 0.08
41 0.09
42 0.09
43 0.1
44 0.1
45 0.1
46 0.1
47 0.1
48 0.1
49 0.1
50 0.1
51 0.1
52 0.1
53 0.1
54 0.1
55 0.1
56 0.1
57 0.1
58 0.11
59 0.11
60 0.11
61 0.13
62 0.13
63 0.13
64 0.18
65 0.22
66 0.23
67 0.24
68 0.27
69 0.34
70 0.37
71 0.37
72 0.37
73 0.4
74 0.44
75 0.46
76 0.44
77 0.41
78 0.43
79 0.44
80 0.42
81 0.41
82 0.44
83 0.46
84 0.51
85 0.55
86 0.56
87 0.64
88 0.68
89 0.65
90 0.69
91 0.73
92 0.7
93 0.71
94 0.73
95 0.69
96 0.71
97 0.75
98 0.7
99 0.7
100 0.73
101 0.7
102 0.71
103 0.75
104 0.7
105 0.72
106 0.75
107 0.7
108 0.69
109 0.69
110 0.65
111 0.63
112 0.63
113 0.55
114 0.55
115 0.57
116 0.51
117 0.47
118 0.42
119 0.36
120 0.31
121 0.33
122 0.26
123 0.22
124 0.2
125 0.18
126 0.21
127 0.21
128 0.22
129 0.24
130 0.26
131 0.28
132 0.34
133 0.39
134 0.39
135 0.41
136 0.41
137 0.36
138 0.34
139 0.33
140 0.32
141 0.29
142 0.25
143 0.24
144 0.25
145 0.29
146 0.34
147 0.32
148 0.32
149 0.36
150 0.43
151 0.47
152 0.51
153 0.49
154 0.46
155 0.49
156 0.5
157 0.52
158 0.49
159 0.51
160 0.47
161 0.42
162 0.41
163 0.37
164 0.33
165 0.24
166 0.21
167 0.14
168 0.1
169 0.09
170 0.09
171 0.09
172 0.09
173 0.1
174 0.08
175 0.1
176 0.11
177 0.11
178 0.12
179 0.14
180 0.16
181 0.19
182 0.24
183 0.27
184 0.28
185 0.34
186 0.37
187 0.38
188 0.4
189 0.4
190 0.38