Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4K4Y0

Protein Details
Accession A0A3N4K4Y0    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
44-80RGVEKEKKRLRRDRAISFKEKKKKRKKKSGEVPVLSKBasic
NLS Segment(s)
PositionSequence
47-73EKEKKRLRRDRAISFKEKKKKRKKKSG
Subcellular Location(s) mito 14, nucl 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MSGRRRLVRIREERPGASVREIWEAVEQQGMGTVGVRTVSRFLRGVEKEKKRLRRDRAISFKEKKKKRKKKSGEVPVLSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.55
3 0.46
4 0.39
5 0.35
6 0.27
7 0.27
8 0.26
9 0.22
10 0.21
11 0.19
12 0.17
13 0.15
14 0.13
15 0.08
16 0.09
17 0.09
18 0.06
19 0.06
20 0.05
21 0.05
22 0.05
23 0.06
24 0.05
25 0.07
26 0.08
27 0.09
28 0.1
29 0.11
30 0.18
31 0.2
32 0.28
33 0.35
34 0.42
35 0.5
36 0.57
37 0.65
38 0.67
39 0.75
40 0.76
41 0.77
42 0.79
43 0.8
44 0.83
45 0.81
46 0.82
47 0.81
48 0.82
49 0.82
50 0.83
51 0.83
52 0.84
53 0.88
54 0.89
55 0.91
56 0.93
57 0.94
58 0.96
59 0.96
60 0.96