Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3N4J9E0

Protein Details
Accession A0A3N4J9E0    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
46-67QATNKRKTYKPPDGHLRRRIRPBasic
NLS Segment(s)
PositionSequence
51-68RKTYKPPDGHLRRRIRPH
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
Amino Acid Sequences MTPPLLHLHFRPGLQITMSSALLPHRPSNPAKLRWHIIIILTNLRQATNKRKTYKPPDGHLRRRIRPHLAHPPKPEQTPPQPQPTISLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.24
3 0.19
4 0.18
5 0.18
6 0.15
7 0.13
8 0.13
9 0.15
10 0.17
11 0.17
12 0.17
13 0.21
14 0.23
15 0.32
16 0.39
17 0.43
18 0.46
19 0.48
20 0.49
21 0.46
22 0.45
23 0.36
24 0.3
25 0.25
26 0.21
27 0.2
28 0.17
29 0.17
30 0.15
31 0.15
32 0.15
33 0.16
34 0.24
35 0.3
36 0.38
37 0.42
38 0.47
39 0.56
40 0.64
41 0.72
42 0.68
43 0.67
44 0.7
45 0.76
46 0.8
47 0.81
48 0.8
49 0.77
50 0.79
51 0.78
52 0.76
53 0.72
54 0.71
55 0.72
56 0.74
57 0.74
58 0.72
59 0.74
60 0.71
61 0.68
62 0.65
63 0.62
64 0.62
65 0.64
66 0.64
67 0.64
68 0.61
69 0.58